Search found 4 matches

by monkey07
Mon Jun 01, 2009 4:34 pm
Forum: Molecular Biology
Topic: Optical density Q
Replies: 0
Views: 6044

Optical density Q

In an experiment it is found that the optical density of a solution of compound X was 0.7 when measured at 400nm. in a 1cm glass cuvette. The solution had been prepared by dissolving 35mg of X in 50 ml of water. What is the molar extinction coefficient of X at 400nm? (mol. wt. of X is 450) (20% of t...
by monkey07
Wed May 06, 2009 4:18 pm
Forum: Genetics
Topic: primer design - please help
Replies: 3
Views: 2852

Re: primer design - please help

Ive got the full amino acid sequence for Sox4: M VQQTNNAENTEALLAGESSDSGAGLELGIASSPTPGSTASTGG KADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKD SDKIPFIREAERLRLKHMADYPDYKYRP RKKVKSGNANSSSSAAASSKPGEKGDKVGG SGGGGHGGGGGGGSSNAGGGGGGASGGGANSKPAQKKSCGSKVAGGAGGGVSKPHAKL ILAGGGGGGKAAAAAAASFAAEQAGAAAL...
by monkey07
Tue May 05, 2009 4:18 pm
Forum: Molecular Biology
Topic: Radioactivity Q
Replies: 0
Views: 3524

Radioactivity Q

Can anyone offer any help on the following Q: The enzyme deoxynucleotidyl terminal transferase (TdT) catalyses the addition of dNTPs onto the 3’ ends of double stranded DNA molecules. In an experiment to determine the rate at which the TdT added dNTPs to the 3’ end of DNA, the following experiment w...
by monkey07
Tue May 05, 2009 4:15 pm
Forum: Genetics
Topic: primer design - please help
Replies: 3
Views: 2852

primer design - please help

Ive been given the sequence for a Human Sox4 protein..need to design primers to amplify DNA sequences encoding the HMG box only

HMG box : IK RPMNAFMVWS QIERRKIMEQ SPDMHNAEIS KRLGKRWKLL KDSDKIPFIR EAERLRLKHM ADYPDYDYRP


Does anyone know how to do this??